SAB1400666
Monoclonal Anti-CIDEC antibody produced in mouse
clone 2E2, purified immunoglobulin, buffered aqueous solution
Sinonimo/i:
Anti-CIDE-3, Anti-FLJ20871, Anti-Fsp27
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
mouse
Coniugato
unconjugated
Forma dell’anticorpo
purified immunoglobulin
Tipo di anticorpo
primary antibodies
Clone
2E2, monoclonal
Forma fisica
buffered aqueous solution
Reattività contro le specie
human
tecniche
indirect ELISA: suitable
western blot: 1-5 μg/mL
Isotipo
IgG1κ
N° accesso UniProt
Condizioni di spedizione
dry ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... CIDEC(63924)
Descrizione generale
CIDEC (cell death inducing DFFA (DNA fragmentation factor subunit α) like effector c) is mapped to human chromosome 3p25.3. The gene codes for FSP27 (fat-specific protein 27), also known as CIDEC. The encoded protein is localized to the lipid droplets surface. The gene is predominantly expressed in white adipose tissues and also expressed in liver and kidney.
Immunogeno
CIDEC (NP_071377.2, 53 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA
Sequence
SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA
Azioni biochim/fisiol
CIDEC (cell death inducing DFFA (DNA fragmentation factor subunit α) like effector c) might be responsible for adipocytes differentiation. It is involved in the regulation of lipid droplet morphology and controls the lipid droplets size by inhibiting lipolysis. It is responsible for the triglycerides buildup in adipocytes. Upregulation of the gene is observed in obesity. Overexpression of the gene decreases the fatty acid oxidation (FAO) rate.
Cell death-inducing DFFA-like effector protein C (CIDEC) has a role in the differentiation of adipocytes. It associates with 5′ adenosine monophosphate-activated protein kinase (AMPK) α subunit 1 and acts as a negative regulator of the AMPK complex. CIDEC is also involved in lipid storage and it modulates the size of lipid droplets. The protein has been linked to obesity.
Stato fisico
Solution in phosphate buffered saline, pH 7.4
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Bilal Haider Shamsi et al.
PloS one, 9(9), e106992-e106992 (2014-09-12)
Obesity is a metabolic disorder that can lead to high blood pressure, increased blood cholesterol and triglycerides, insulin resistance, and diabetes mellitus. The aim was to study the effects of pioglitazone mediated sensitization of peroxisome proliferator-activated receptor gamma (PPAR-γ) on
Ming Yu et al.
Molecular and cellular biochemistry, 378(1-2), 145-151 (2013-03-12)
Clear cell renal cell carcinoma (ccRCC) is the major and aggressive subtype of renal cell carcinoma. It is known to derive its histologic appearance from accumulation of abundant lipids and glycogens. The cell death-inducing DFF45-like effector (CIDE) family has been
Maneet Singh et al.
The Journal of biological chemistry, 289(21), 14481-14487 (2014-04-20)
Lipolysis in fat tissue represents a major source of circulating fatty acids. Previously, we have found that lipolysis in adipocytes is controlled by early growth response transcription factor Egr1 that directly inhibits transcription of adipose triglyceride lipase, ATGL (Chakrabarti, P.
Frederic Reinier et al.
Metabolism: clinical and experimental, 64(11), 1530-1540 (2015-09-10)
Lipodystrophies are a large heterogeneous group of genetic or acquired disorders characterized by generalized or partial fat loss, usually associated with metabolic complications such as diabetes mellitus, hypertriglyceridemia and hepatic steatosis. Many efforts have been made in the last years
Ming-Jiang Xu et al.
Gastroenterology, 149(4), 1030-1041 (2015-06-24)
Alcoholic steatohepatitis (ASH) is the progressive form of alcoholic liver disease and may lead to cirrhosis and hepatocellular carcinoma. We studied mouse models and human tissues to identify molecules associated with ASH progression and focused on the mouse fat-specific protein
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.