Passa al contenuto
Merck
Tutte le immagini(6)

Documenti fondamentali

HPA028897

Sigma-Aldrich

Anti-SMAD7 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-MADH7, Anti-MADH8, Anti-SMAD family member 7

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
505,00 €

505,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
505,00 €

About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

505,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

tecniche

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Sequenza immunogenica

EVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNG

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SMAD7(4092)

Cerchi prodotti simili? Visita Guida al confronto tra prodotti

Descrizione generale

SMAD7 (mothers against decapentaplegic homolog 7) is a Tbx1 (T-box 1) interacting gene. It is an inhibitor of the TGFβ (transforming growth factor β) /BMP (bone morphogenetic proteins) pathway. It is located on chromosome 18q21.1.

Immunogeno

SMAD family member 7 recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-SMAD7 has been used in immunohistochemistry.

Azioni biochim/fisiol

SMAD7 (mothers against decapentaplegic homolog 7) is a modulator of TGFβ(transforming growth factor β) signaling in immune cells that are associated to ulcerative colitis and inflammatory bowel syndrome. It plays a major role in the etiology of CRC (colorectal cancer). It even functions as a mediator of the negative feedback loop for both the TGFβ and BMP (bone morphogenetic proteins) signaling pathways. It is essential for the remodelling of pharyngeal artery and the enlargement of great vessel. In mouse, homozygous removal of Smad7 causes primarily fourth-related arch artery defects. Silencing of Smad7 in RCD (refractory coeliac disease) biopsy samples can decrease the expression of interleukin-6 and tumour necrosis factor-α. Polymorphism of this gene is associated with colorectal cancer.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86713

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Vjera Mihaljević et al.
Biomedicines, 10(11) (2022-11-27)
Aims: Chronic diabetes complications, including diabetic nephropathy (DN), frequently result in end-stage renal failure. This study investigated empagliflozin (SGLT2i) effects on collagen synthesis, oxidative stress, cell survival, and protein expression in an LLC-PK1 model of DN. Methods: Combinations of high
High Smad7 sustains inflammatory cytokine response in refractory coeliac disease
Sedda S, et al.
Immunology, 150(3), 356-363 (2017)
Tbx1 genetically interacts with the transforming growth factor-?/bone morphogenetic protein inhibitor Smad7 during great vessel remodeling
Papangeli I and Scambler PJ
Circulation Research, 112(1), 90-102 (2013)
Multiple functional risk variants in a SMAD7 enhancer implicate a colorectal cancer risk haplotype
Fortini BK, et al.
PLoS ONE, 9(11) (2014)
Intronic polymorphisms of the SMAD7 gene in association with colorectal cancer
Damavand B, et al.
Asian Pacific Journal of Cancer Prevention, 16(1), 41-44 (2015)

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.