HPA015243

Anti-ADCY10 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-AH-related protein, Anti-Adenylate cyclase homolog, Anti-Adenylate cyclase type 10, Anti-Germ cell soluble adenylyl cyclase, Anti-Testicular soluble adenylyl cyclase, Anti-hsAC, Anti-sAC
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA015243
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunohistochemistry: 1:50- 1:200
• Sequenza immunogenica: NLENLVAQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWLNMNKESWYSTSELKEDQWLQTILSLPSW
• N° accesso UniProt: Q96PN6
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ADCY10(55811)

Descrizione

Descrizione generale

ADCY10 (adenylate cyclase 10) is the soluble member of ten homologous adenylyl cyclases (ACs). The rest of the members are transmembrane proteins. It has two alternatively spliced isoforms, produced due to exclusion/ inclusion of exon 12. The full-length form contains additional ~1,100 residues, which act as an auto-inhibitory as well as heme-binding domain. This form also contains its active site at the N-terminal. The second isoform is truncated and contains two catalytic domains. This isoform has a wider range of expression.

Immunogeno

Adenylate cyclase type 10 recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Azioni biochim/fisiol

ADCY10 (adenylate cyclase 10) is induced by bicarbonate (HCO3^-), and produces the secondary messenger called cAMP. Thus, it monitors the physiological pH during various processes such as, activation of sperm, aqueous humor production and regulation of metabolism. It also forms a target for male contraceptives, and has been linked to prostate and skin cancer. Studies in fibroblast cultures show that KH7 prevents the formation of cAMP by ADCY10 in the mitochondrial matrix. This results in a decrease in the free forms of NDUFS4 (NADH dehydrogenase (ubiquinone) Fe-S protein 4), NDUFV2 (NADH dehydrogenase (ubiquinone) flavoprotein 2) and NDUFA9 (NADH dehydrogenase (ubiquinone) 1 α subcomplex, 9) subunits forming the catalytic unit, leading to the suppression of the activity of complex I of the respiratory chain. Thus, this enzyme controls the mammalian respiratory chain complex I.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72898

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)