HPA005544

Anti-MTA1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Metastasis-associated protein MTA1 antibody produced in rabbit
• Numero MDL: MFCD07370404
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA005544
• NACRES: NA.43

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Sequenza immunogenica: LEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETK
• N° accesso UniProt: Q13330
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MTA1(9112)

Descrizione

Descrizione generale

Metastasis tumor antigen 1 (MTA1) is a part of the nucleosome remodeling and deacetylating (NuRD) complex, and is also a candidate member for the metastasis-associated family of genes. MTA1 is localized to chromosomal position 14q32.3. This protein is localized in the nucleus. It has a molecular weight of ~82kDa and consists of 715 amino acids. The C-terminus of MTA1 consists of a proline-rich region or the SH3 (SRC homology 3)-binding domain. It is also composed of a leucine zipper, a putative DNA-binding zinc finger motif and five SPXX motifs.

Immunogeno

Metastasis-associated protein MTA1 recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Azioni biochim/fisiol

Metastasis tumor antigen 1 (MTA1) is a gene related to the progression of cancer. Its expression is up-regulated in various cancers, such as liver, breast, ovarian and colorectal cancer. As a component of nucleosome remodeling and deacetylating (NuRD) complex, it is thought to play a role in transcription control and chromatin remodeling. It acts as a repressor of estrogen receptor α (ERα), and an activator of Breast Cancer Amplified Sequence 3 (BCAS3). BCAS3 gene is overexpressed in breast cancers, and hence, MTA1 might play a role in tumorigenesis of breast cancer. MTA1 activates paired box gene 5 (Pax5), which in turn is up-regulated in B-cell lymphomas. Hence, MTA1 might be involved in lymphogenesis. When up-regulated in cells, this protein leads to chromosomal instability and aberrant number of centrosomes. This is achieved by the suppression of BRCA1, which is a tumor suppressor gene.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70514

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)