AV52418

Anti-COL4A3BP antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-CERT, Anti-CERTL, Anti-Collagen, type IV, α-3 (Goodpasture antigen) binding protein, Anti-FLJ20597, Anti-GPBP, Anti-STARD11
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 68 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_112729
• N° accesso UniProt: Q9Y5P4
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... COL4A3BP(10087)

Descrizione

Immunogeno

Synthetic peptide directed towards the N terminal region of human COL4A3BP

Azioni biochim/fisiol

COL4A3BP is a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport.This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Two transcripts exist for this gene.

Sequenza

Synthetic peptide located within the following region: PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable