Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV50121

Sigma-Aldrich

Anti-JAM3 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Junctional adhesion molecule 3

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
498,00 €

498,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
498,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

498,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

28 kDa

Reattività contro le specie

human, guinea pig, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... JAM3(83700)

Descrizione generale

The gene Junctional adhesion molecule 3 (JAM3; JAM-C) is mapped to human chromosme 11q25. JAM3 is a type I transmembrane glycoprotein and contains Ig-like domains. It belongs to Ig-superfamily called as JAMs. JAM3 is widely expressed with predominant expression in placenta, brain and kidney. It is also expressed in platelets but not in other blood cells.

Immunogeno

Synthetic peptide directed towards the N terminal region of human JAM3

Applicazioni

Anti-JAM3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Azioni biochim/fisiol

Junctional adhesion molecule 3 (JAM3; JAM-C) is a protein localized at the tight junctions of endothelial cells and acts as a receptor for another JAM molecule. JAM3 is involved in the regulation of vascular permeability, angiogenesis and nerve function. Deficient expression of JAM3 results in severe hydrocephalus[1] and development of tumors in murine models. JAM3 is involved in lymphangiogenesis and nodal metastasis in non-small cell lung cancer.[2] It is also associated with melanoma cell metastasis.

Sequenza

Synthetic peptide located within the following region: SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

David A Leinster et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 27(10), 4244-4253 (2013-07-05)
Junctional adhesion molecule C (JAM-C) is a transmembrane protein with significant roles in regulation of endothelial cell (EC) functions, including immune cell recruitment and angiogenesis. As these responses are important in promoting tumor growth, the role of EC JAM-C in
Harald F Langer et al.
Cancer research, 71(12), 4096-4105 (2011-05-20)
Hematogenous dissemination of melanoma is a life-threatening complication of this malignant tumor. Here, we identified junctional adhesion molecule-C (JAM-C) as a novel player in melanoma metastasis to the lung. JAM-C expression was identified in human and murine melanoma cell lines
Sentot Santoso et al.
The Journal of experimental medicine, 196(5), 679-691 (2002-09-05)
The recently described junctional adhesion molecules (JAMs) in man and mice are involved in homotypic and heterotypic intercellular interactions. Here, a third member of this family, human JAM-3, was identified and described as a novel counterreceptor on platelets for the
Lena Wyss et al.
PloS one, 7(9), e45619-e45619 (2012-10-03)
The junctional adhesion molecule (JAM)-C is a widely expressed adhesion molecule regulating cell adhesion, cell polarity and inflammation. JAM-C expression and function in the central nervous system (CNS) has been poorly characterized to date. Here we show that JAM-C(-/-) mice
Christoph Scheiermann et al.
Science (New York, N.Y.), 318(5855), 1472-1475 (2007-12-01)
JAM-C is an adhesion molecule that is expressed on cells within the vascular compartment and epithelial cells and, to date, has been largely studied in the context of inflammatory events. Using immunolabeling procedures in conjunction with confocal and electron microscopy

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.