Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV38287

Sigma-Aldrich

Anti-NR2C1 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Nuclear receptor subfamily 2, group C, member 1, Anti-TR2, Anti-TR2-11

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
498,00 €

498,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
498,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

498,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

67 kDa

Reattività contro le specie

guinea pig, rat, horse, bovine, human, mouse, dog

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... NR2C1(7181)

Descrizione generale

Testicular receptor 2 /nuclear receptor subfamily 2, group C, member 1 (NR2C1, TR2) is a nuclear receptor transcription factor. TR2 is a testicular orphan nuclear receptors that acts to regulate other nuclear receptors. TR2 is believed to regulate early embryonic development by regulating key genes involved in stem cell self-renewal, commitment and differentiation. TR2/TR4 directly represses Gata1/GATA1 transcription in murine and human erythroid progenitor cells.

The previously assigned protein identifier Q15625 has been merged into P13056. Full details can be found on the UniProt database.

Specificità

Anti-NR2C1 polyclonal antibody reacts with zebrafish, canine, bovine, human, mouse, and rat testicular receptor 2 proteins.

Immunogeno

Synthetic peptide directed towards the C terminal region of human NR2C1

Applicazioni

Anti-NR2C1 polyclonal antibody is used to tag testicular receptor 2 /Nuclear receptor subfamily 2, group C, member 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of testicular receptor 2 in early embryonic development and stem cell self-renewal, commitment and differentiation.

Azioni biochim/fisiol

The nuclear orphan receptors NR2C1 represses transcription and binds DNA as a homodimer. NR2C1 binds the IR7 element in the promoter of its own gene in an autoregulatory negative feedback mechanism. NR2C1 may function as a negative modulator to suppress androgen receptor function in prostate cancer. NR2C1 may exert an important repressor in regulating ER activity in mammary glands. The nuclear orphan receptors TR2 (NR2C1) and TR4 form a heterodimer that binds to the epsilon and gamma globin promoter DR1 sites

Sequenza

Synthetic peptide located within the following region: LPALRLMNATITEELFFKGLIGNIRIDSVIPHILKMEPADYNSQIIGHSI

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 2

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.