Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV36000

Sigma-Aldrich

Anti-HES4 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Hairy and enhancer of split 4 (Drosophila)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
382,00 €

382,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
382,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

382,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

24 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... HES4(57801)

Immunogeno

Synthetic peptide directed towards the middle region of human HES4

Azioni biochim/fisiol

HES4 has been identified as transcriptional repressor that is positively regulated by Wnt signaling pathway. In conjunction with Notch signaling targets, Hes proteins regulate cell differentiation, embryonic patterning and cell fate decisions.[1][2]

Sequenza

Synthetic peptide located within the following region: GHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLA

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Kan-Ichiro Nagatomo et al.
Developmental dynamics : an official publication of the American Association of Anatomists, 236(6), 1475-1483 (2007-04-17)
The neural crest is a population of mitotically active, multipotent progenitor cells that arise at the neural plate border. Neural crest progenitors must be maintained in a multipotent state until after neural tube closure. However, the molecular underpinnings of this
Warif El Yakoubi et al.
Stem cells (Dayton, Ohio), 30(12), 2784-2795 (2012-09-13)
The retina of fish and amphibian contains genuine neural stem cells located at the most peripheral edge of the ciliary marginal zone (CMZ). However, their cell-of-origin as well as the mechanisms that sustain their maintenance during development are presently unknown.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.