Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

AV35458

Sigma-Aldrich

Anti-KCNQ2 (AB2) antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-BFNC, Anti-EBN, Anti-EBN1, Anti-ENB1, Anti-HNSPC, Anti-KCNA11, Anti-KV7.2, Anti-Potassium voltage-gated channel, KQT-like subfamily, member 2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
498,00 €

498,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.
Per il tuo target è disponibile un anticorpo ricombinante privo di conservanti. Prova ZRB1299


Scegli un formato

Cambia visualizzazione
100 μL
498,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

498,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.
Per il tuo target è disponibile un anticorpo ricombinante privo di conservanti. Prova ZRB1299

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

44 kDa

Reattività contro le specie

rat, bovine, horse, mouse, human, dog, guinea pig

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... KCNQ2(3785)

Immunogeno

Synthetic peptide directed towards the N terminal region of human KCNQ2

Azioni biochim/fisiol

The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by KCNQ2 and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by this gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in this gene are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1). At least five transcript variants encoding five different isoforms have been found for this gene.

Sequenza

Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

N° Catalogo
Descrizione
Determinazione del prezzo

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 2

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.