Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV34957

Sigma-Aldrich

Anti-CACNB3 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Calcium channel, voltage-dependent, β 3 subunit

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
287,00 €

287,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
287,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

287,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

53 kDa

Reattività contro le specie

horse, human, guinea pig, rat, mouse, bovine, rabbit, dog

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CACNB3(784)

Descrizione generale

Voltage-dependent L-type calcium channel subunit β-3 (CACNB3) is the β subunit critical for proper functioning of the voltage-dependent L-type calcium channel by increasing calcium current. It is a 54 kDa protein shown to be critical for renal and cardiac cell functioning as well as the survival of CD8+ T lymphocytes.

Immunogeno

Synthetic peptide directed towards the C terminal region of human CACNB3

Azioni biochim/fisiol

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Sequenza

Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Henry M Colecraft et al.
The Journal of physiology, 541(Pt 2), 435-452 (2002-06-04)
Recombinant adenoviruses were used to overexpress green fluorescent protein (GFP)-fused auxiliary Ca(2+) channel beta subunits (beta(1)-beta(4)) in cultured adult rat heart cells, to explore new dimensions of beta subunit functions in vivo. Distinct beta-GFP subunits distributed differentially between the surface
Mithilesh K Jha et al.
Nature immunology, 10(12), 1275-1282 (2009-10-20)
The survival of T lymphocytes requires sustained, Ca(2+) influx-dependent gene expression. The molecular mechanism that governs sustained Ca(2+) influx in naive T lymphocytes is unknown. Here we report an essential role for the beta3 regulatory subunit of voltage-gated calcium (Ca(v))

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.