GABA-A is a receptor for the major inhibitory neurotransmitter in mammalian brain, gamma-aminobutyric acid (GABA). Gamma-Aminobutyric acid (GABA) A receptor, α-2 (GABRA2) is one of sixteen subunits of GABA-A receptors currenly identified. Variants in GABRA2 have been cautiously associated with alcoholism.
Rabbit polyclonal anti-GABRA2 antibody reacts with canine, bovine, human, mouse, and rat Gamma-Aminobutyric acid (GABA) A receptor, α-2 subunits.
Immunogeno
Synthetic peptide directed towards the middle region of human GABRA2
Applicazioni
Rabbit polyclonal anti-GABRA2 antibody is used to tag Gamma-Aminobutyric acid (GABA) A receptor, α-2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Gamma-Aminobutyric acid (GABA) A receptor, α-2 in alcohol dependency/alcoholism. Anti-GABRA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.
Sequenza
Synthetic peptide located within the following region: PMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQ
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
American journal of physiology. Gastrointestinal and liver physiology, 317(1), G40-G50 (2019-05-03)
Perinatal high-fat diet (pHFD) exposure increases the inhibition of dorsal motor nucleus of the vagus (DMV) neurons, potentially contributing to the dysregulation of gastric functions. The aim of this study was to test the hypothesis that pHFD increases the inhibition
Domande
Recensioni
★★★★★ Nessuna valutazione
Filtri attivi
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
