Passa al contenuto
Merck
Tutte le immagini(9)

Documenti fondamentali

AMAB91116

Sigma-Aldrich

Monoclonal Anti-SLC6A2 antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL3063, purified immunoglobulin, buffered aqueous glycerol solution

Sinonimo/i:

NAT1, NET1, SLC6A2, SLC6A5

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
505,00 €

505,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
505,00 €

About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

505,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

CL3063, monoclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human, rat, mouse

tecniche

immunohistochemistry: 1:200-1:500

Isotipo

IgG1

Sequenza immunogenica

SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... NET(6530)

Categorie correlate

Descrizione generale

Sodium-dependent noradrenaline transporter (NET) is also called solute carrier family 6 member 2 (SLC6A2). The SLC6A2 gene is mapped to locus 16q12.2 in the human chromosome. The sodium-dependent noradrenaline transporter (NET) belongs to sodium and chloride-dependent neurotransmitter transporter family and is a glycosylated protein.

Immunogeno

Solute carrier family 6 member 2

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Azioni biochim/fisiol

Regulation of noradrenalin transport is the primary function of the norepinephrine transporter (NET).It is crucial for neuronal function and regulates neurotransmitter uptake in the central nervous system. Polymorphisms in NET gene is implicated in attention-deficit/hyperactivity disorder (ADHD). Mutations in NET impacts the transport functionality resulting in orthostatic intolerance disorder. Polymorphisms of SLC6A2 impacts neurotransmission in patients with major depressive disorder.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86859

Stato fisico

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Differential association between the norepinephrine transporter gene and ADHD: role of sex and subtype
Sengupta SN, et al.
Journal of Psychiatry & Neuroscience, 37(2), 129-129 (2012)
Association between norepinephrine transporter gene (SLC6A2) polymorphisms and suicide in patients with major depressive disorder
Kim YK, et al.
Journal of Affective Disorders, 158, 127-132 (2014)
Comprehensive phenotype/genotype analyses of the norepinephrine transporter gene (SLC6A2) in ADHD: relation to maternal smoking during pregnancy
Thakur GA, et al.
PLoS ONE, 7(11), e49616-e49616 (2012)
Alleviating transcriptional inhibition of the norepinephrine slc6a2 transporter gene in depolarized neurons
Harikrishnan KN, et al.
The Journal of Neuroscience, 30(4), 1494-1501 (2010)
A mutation in the human norepinephrine transporter gene (SLC6A2) associated with orthostatic intolerance disrupts surface expression of mutant and wild-type transporters
Hahn MK, et al.
The Journal of Neuroscience, 23(11), 4470-4478 (2003)

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.