5093
CD40 human
recombinant, expressed in E. coli, 0.5 mg protein/mL
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Scegli un formato
100 μG
319,00 €
319,00 €
Per informazioni sulla disponibilità, contatta il Servizio Clienti.
Scegli un formato
Cambia visualizzazione
100 μG
319,00 €
About This Item
Codice UNSPSC:
12352202
NACRES:
NA.75
319,00 €
Per informazioni sulla disponibilità, contatta il Servizio Clienti.
Prodotti consigliati
Origine biologica
human
Ricombinante
expressed in E. coli
Descrizione
0.1 mg of recombinant human CD40 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
Sterilità
Filtered sterilized solution
Saggio
≥90% (SDS-PAGE)
Stato
liquid
Confezionamento
pkg of 100 μg
Concentrazione
0.5 mg protein/mL
tecniche
cell culture | mammalian: suitable
Numero d’accesso
NP_690593
Condizioni di spedizione
dry ice
Temperatura di conservazione
−20°C
Informazioni sul gene
human ... CD40LG(959)
Applicazioni
Coating a plate well (6 well plate) with this recombinant CD40 protein in neuronal cell specific medium at 1-10 μg/well (6 well plate) allows for 1) human neuronal cell / receptor interaction studies or 2) use as a culture matrix protein for human neuronal axon connection studies in vitro.
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1.Thaw CD40 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2.Add appropriate amount of diluted material to culture surface.
3.Incubate at room temperature for approximately 1.5 hours.
4.Aspirate remaining material.
5.Rinse plates carefully with water and avoid scratching bottom surface of plates.
6.Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1.Thaw CD40 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2.Add appropriate amount of diluted material to culture surface.
3.Incubate at room temperature for approximately 1.5 hours.
4.Aspirate remaining material.
5.Rinse plates carefully with water and avoid scratching bottom surface of plates.
6.Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.
Sequenza
MASMTGGQQMGRGHHHHHHGNLYFQGGEFELEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTRSPGSAESPGGDPHHLRDPVCHPLGAGL
Nota sulla preparazione
The full-length extracellular domain of the human CD40 gene (54-608 aa) was constructed with 29 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 2
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Joel N Glasgow et al.
PloS one, 4(12), e8355-e8355 (2009-12-23)
Successful gene therapy will require targeted delivery vectors capable of self-directed localization. In this regard, the use of antibodies or single chain antibody fragments (scFv) in conjunction with adenovirus (Ad) vectors remains an attractive means to achieve cell-specific targeting. However
Mohsen Arabpour et al.
Molecular immunology, 114, 172-178 (2019-07-30)
B lymphocytes with regulatory or effector functions synthesize granzyme B (GZMB). We investigated the frequency and phenotype of GZMB-producing B cells in breast tumor-draining lymph nodes (TDLNs). Mononuclear cells were isolated from 48 axillary lymph nodes and were stimulated with
Simon N Willis et al.
Nature communications, 8(1), 1426-1426 (2017-11-12)
Humoral immunity requires B cells to respond to multiple stimuli, including antigen, membrane and soluble ligands, and microbial products. Ets family transcription factors regulate many aspects of haematopoiesis, although their functions in humoral immunity are difficult to decipher as a
E A Clark et al.
Proceedings of the National Academy of Sciences of the United States of America, 83(12), 4494-4498 (1986-06-01)
Two human B-cell differentiation antigens, Bp35 and Bp50, apparently play distinct roles as signal receptors in B-cell activation. Monoclonal antibodies (mAbs) to either Bp35 or Bp50 deliver positive signals to B cells that stimulate their transition through the cell cycle.
Priyadharshini Narayanan et al.
The Journal of clinical investigation, 121(4), 1524-1534 (2011-03-09)
The in vivo therapeutic efficacy of DC-based cancer vaccines is limited by suboptimal DC maturation protocols. Although delivery of TLR adjuvants systemically boosts DC-based cancer vaccine efficacy, it could also increase toxicity. Here, we have engineered a drug-inducible, composite activation
Filtri attivi
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.
