WH0008518M3

Monoclonal Anti-IKBKAP antibody produced in mouse

clone 6G9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): DKFZp781H1425, DYS, ELP1, FD, IKAP, IKI3, TOT1, inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
• MDL number: MFCD04118553
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 6G9, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: NM_003640
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... IKBKAP(8518)

Description

Immunogen

IKBKAP (NP_003631, 1242 a.a. ~ 1331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL

Biochem/physiol Actions

The protein encoded by this gene is a scaffold protein and a regulator for 3 different kinases involved in proinflammatory signaling. This encoded protein can bind NF-kappa-B-inducing kinase (NIK) and IKKs through separate domains and assemble them into an active kinase complex. Mutations in this gene have been associated with familial dysautonomia. (provided by RefSeq)

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves