Saltar al contenido
Merck

MSST0058

Sigma-Aldrich

SILuLite IL8, Interleukin-8 human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Sinónimos:

C-X-C motif chemokine 8, Chemokine (C-X-C motif), Emoctakin, Granulocyte chemotactic protein 1 (GCP-1), IL-8, Monocyte-derived neutrophil, Monocyte-derived neutrophil-activating peptide (MONAP), Neutrophil-activating protein 1 (NAP-1), Protein 3-10C, T-cell chemotactic factor, chemotactic factor (MDNCF), ligand 8

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

50 μG
688,00 €

688,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

Solicitar un pedido a granel

Seleccione un Tamaño

Cambiar Vistas
50 μG
688,00 €

About This Item

Código UNSPSC:
23201100
NACRES:
NA.32

688,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

Solicitar un pedido a granel

recombinante

expressed in HEK 293 cells

Nivel de calidad

Ensayo

≥95% (SDS-PAGE)

Formulario

lyophilized powder

idoneidad

suitable for mass spectrometry (internal calibrator)

Nº de acceso UniProt

Condiciones de envío

ambient

temp. de almacenamiento

−20°C

Información sobre el gen

human ... CXCL8(3576)

Categorías relacionadas

Descripción general

SILuLite IL8 is a recombinant human protein expressed in human 293 cells. It is a mixture of the 3 main CXCL8 isoforms with the molecular weights, amino acid number and relative abundance as described in Table 1 of the product datasheet. SILuLite IL8 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Acciones bioquímicas o fisiológicas

Interleukin-8 (IL-8) is a member of the CXC chemokine subfamily and is produced by blood cells and many types of tissues. The measurement of IL-8 in voided urinary samples may have utility for urine-based detection of bladder cancer. Urinary IL-8 was a strong biomarker of stress under intensive and prolonged demands, both acutely and over time. IL-8 and cathepsin B levels were significantly elevated in melanoma patients, and more importantly, the combination of IL-8 and cathepsin B were also studied as a prognosis marker for melanoma mortality.

Secuencia

EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Información legal

SILu is a trademark of Sigma-Aldrich Co. LLC

Código de clase de almacenamiento

11 - Combustible Solids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico