Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

AV38941

Sigma-Aldrich

Anti-TARDBP (AB1) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-TAR DNA binding protein

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
326,00 €

326,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad


Seleccione un Tamaño

Cambiar Vistas
100 μL
326,00 €

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

326,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

45 kDa

reactividad de especies

bovine, rat, guinea pig, human, dog, horse, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... TARDBP(23435)

Descripción general

TAR DNA binding protein (TARDBP) is a DNA and RNA binding transcription repressor and regulator of pre-mRNA splicing and translation. TARDBP binds to the regulatory element TAR found in the transcription initiation site of the HIV-1 gene Tat; consequently TARDBP is an active repressor of chromosomally integrated HIV-1 tat. TARDBP also regulates alternative splicing of CFTR and apo-II genes. A defective form of TARDBP is associated with amyotrophic lateral sclerosis (ALS).

Especificidad

Anti-TARDBP (AB1) polyclonal antibody reacts with bovine, human, mouse, rat, chicken, and canine TAR DNA binding protein(s).

Inmunógeno

Synthetic peptide directed towards the N terminal region of human TARDBP

Aplicación

Anti-TARDBP (AB1) polyclonal antibody is used to tag TAR DNA binding protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of TAR DNA binding protein in the repression of gene expression and regulation of pre-mRNA splicing and translation.

Acciones bioquímicas o fisiológicas

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARDBP is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription.HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.

Secuencia

Synthetic peptide located within the following region: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Jack L Pinkus et al.
Neuromuscular disorders : NMD, 24(7), 611-616 (2014-05-27)
Previous histopathologic studies of sporadic inclusion body myositis (sIBM) identified sarcoplasmic aggregation and myonuclear depletion of the predominantly nuclear heterogeneous nuclear ribonucleoprotein (hnRNP) TDP-43 in sIBM myofibers. Here, we examined sIBM muscle for abnormalities in two other hnRNPs hnRNPA1 and
Hideaki Tagashira et al.
Biochimica et biophysica acta, 1840(12), 3320-3334 (2014-09-02)
Amyotrophic lateral sclerosis (ALS) is a disease caused by motor neuron degeneration. Recently, a novel SIGMAR1 gene variant (p.E102Q) was discovered in some familial ALS patients. We address mechanisms underlying neurodegeneration caused by the mutation using Neuro2A cells overexpressing σ1R(E102Q)
Chi-Chen Huang et al.
Journal of cell science, 127(Pt 14), 3024-3038 (2014-05-27)
TDP-43 (also known as TARDBP) is a pathological signature protein of neurodegenerative diseases, with TDP-43 proteinopathies including frontotemporal lobar degeneration (FTLD)-TDP and amyotrophic lateral sclerosis (ALS)-TDP. These TDP-43 proteinopathies are characterized by cytoplasmic insoluble TDP-43-positive aggregates in the diseased cells

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico