AV32256

Anti-NR2F6 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Nuclear receptor subfamily 2, group F, member 6
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 43 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_005225
• Nº de acceso UniProt: P10588
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... NR2F6(2063)

Descripción

Descripción general

NR2F6 is a nuclear receptor that functions as PKC substrate. This receptor is known to regulate the responses of CD4+ T cell activation. Rabbit Anti-NR2F6 (AB1) antibody recognizes canine, human, mouse, and rat NR2F6.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human NR2F6

Aplicación

Rabbit Anti-NR2F6 (AB1) antibody can be used for western blot assays at a concentration of 0.1-5.0μg/ml.

Acciones bioquímicas o fisiológicas

NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily

Secuencia

Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable