AV32256

Anti-NR2F6 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Nuclear receptor subfamily 2, group F, member 6
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: 1

Propiedades

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 43 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_005225
• UniProt accession no.: P10588
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NR2F6(2063)

Descripción

General description

NR2F6 is a nuclear receptor that functions as PKC substrate. This receptor is known to regulate the responses of CD4+ T cell activation. Rabbit Anti-NR2F6 (AB1) antibody recognizes canine, human, mouse, and rat NR2F6.

Immunogen

Synthetic peptide directed towards the N terminal region of human NR2F6

Application

Rabbit Anti-NR2F6 (AB1) antibody can be used for western blot assays at a concentration of 0.1-5.0μg/ml.

Biochem/physiol Actions

NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Clase de almacenamiento: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable