Synthetic peptide directed towards the C terminal region of human CMKLR1
Anwendung
Anti-CMKLR1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem./physiol. Wirkung
CMKLR1 is a G-protein coupled receptor that is activated by chemerine, a leukocyte attractant and adipokine. CMKLR1 is expressed in embryonic and adult skeletal muscle, though its role in adults is not clear. It regulates the processes of cell migration and differentiation of myoblasts into myotubes. The role of this receptor is important in adipose tissue development, inflammation, and glucose homeostasis.
Sequenz
Synthetic peptide located within the following region: KKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Adipose tissue secretes a variety of bioactive signaling molecules, termed adipokines, which regulate numerous biological functions including appetite, energy balance, glucose homeostasis, and inflammation. Chemerin is a novel adipokine that regulates adipocyte differentiation and metabolism by binding to and activating
American journal of physiology. Cell physiology, 302(11), C1621-C1631 (2012-03-31)
The chemokine-like receptor-1 (CMKLR1) is a G protein-coupled receptor that is activated by chemerin, a secreted plasma leukocyte attractant and adipokine. Previous studies identified that CMKLR1 is expressed in skeletal muscle in a stage-specific fashion during embryogenesis and in adult
Fragen
Bewertungen
★★★★★ Kein Beurteilungswert
Aktive Filter
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
