WH0008871M2

Monoclonal Anti-SYNJ2 antibody produced in mouse

clone 2H8, purified immunoglobulin, buffered aqueous solution

• Synonyma: Anti-INPP5H, Anti-KIAA0348, Anti-MGC44422, Anti-synaptojanin 2
• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2H8, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_003898
• UniProt accession no.: O15056
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SYNJ2(8871)

Popis

General description

Synaptojanin-2 is a ubiquitously expressed inositol polyphosphate 5-phosphatase (Malecz et al., 2000 [PubMed 11084340]).[supplied by OMIM

Immunogen

SYNJ2 (NP_003889, 1396 a.a. ~ 1495 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHEHKTLGHWVTISDQEKRTALQVFDPLAK

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)