WH0004684M1

Monoclonal Anti-NCAM1 antibody produced in mouse

clone 3G12, purified immunoglobulin, buffered aqueous solution

• Synonyma: Anti-CD56, Anti-MSK39, Anti-NCAM, Anti-neural cell adhesion molecule 1
• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3G12, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: BC047244
• UniProt accession no.: P13591
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NCAM1(4684)

Popis

General description

Neural cell adhesion molecule (NCAM/CD56) is a calcium-independent binding protein. It is located on human chromosome 11q23.1. This molecule belongs to the immunoglobulin superfamily. NCAM1 is present in neurons and glial cells.

Immunogen

NCAM1 (AAH47244, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP

Biochem/physiol Actions

Neural cell adhesion molecule (NCAM/CD56) participates in homophilic cell–cell and heterophilic cell–matrix interactions. It controls the movement of cells and condensation during skeletal development. This protein participates in synaptic plasticity, neurodevelopment and neurogenesis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)