SAB1404683

Monoclonal Anti-DCAMKL1, (C-terminal) antibody produced in mouse

clone 6H4, purified immunoglobulin, buffered aqueous solution

• Synonyma: DCAMKL1, DCDC3A, DCLK, KIAA0369
• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 6H4, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~35.9 kDa
• species reactivity: mouse, human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG
• NCBI accession no.: NM_004734
• UniProt accession no.: O15075
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... DCLK1(9201)

Popis

General description

DCAMKL1 is a microtubule-associated protein that phosphorylates itself and myelin basic protein (MBP; MIM 159430). DCAMKL1 has microtubule polymerizing activity that is independent of its protein kinase activity (Lin et al., 2000 [PubMed 11124993]).[supplied by OMIM

Immunogen

DCAMKL1 (NP_004725, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM

Physical form

Solution in phosphate buffered saline, pH 7.4

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable