Přejít k obsahu
Merck
Všechny fotografie(2)

Key Documents

AV40125

Sigma-Aldrich

Anti-SIRT5 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonyma:

Anti-Sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)

Přihlásitk zobrazení cen stanovených pro organizaci a smluvních cen


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

33 kDa

species reactivity

human, goat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SIRT5(23408)

General description

SIRT5 (Sirtuin 5) is a mitochondrial matrix protein belonging to the class III of the sirtuin family. It is localized inside the mitochondria and within the cytosol and nucleus. The protein is widely expressed in the brain, heart, liver and kidney. It is composed of very short amino and carboxyl terminal sequences flanking region with the conserved, catalytic sirtuin center domain.The previously assigned protein identifier Q5T295 has been merged into Q9NXA8. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the C terminal region of human SIRT5

Application

Anti-SIRT5 (AB2) antibody produced in rabbit is suitable for western blot applications.

Biochem/physiol Actions

SIRT5 (Sirtuin 5) is associated with metabolism and aging process. It has been reported in a study that SIRT5 influences urea cycle pathway by NAD-dependent deacetylation and subsequent activation of carbamoyl phosphate synthetase 1 (CPS1), which plays a vital role in the initial step of urea cycle for the detoxification and removal of ammonia. In non-small cell-lung cancer cells, SIRT5 contributions have also been observed for the cancer cell growth and drug resistance. Study shows that SIRT5 may possess oncogenic property.

Sequence

Synthetic peptide located within the following region: HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFSHLIS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ještě jste nenalezli správný produkt?  

Vyzkoušejte náš produkt Nástroj pro výběr produktů.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Osvědčení o analýze (COA)

Vyhledejte osvědčení Osvědčení o analýze (COA) zadáním čísla šarže/dávky těchto produktů. Čísla šarže a dávky lze nalézt na štítku produktu za slovy „Lot“ nebo „Batch“.

Již tento produkt vlastníte?

Dokumenty související s produkty, které jste v minulosti zakoupili, byly za účelem usnadnění shromážděny ve vaší Knihovně dokumentů.

Navštívit knihovnu dokumentů

Takashi Nakagawa et al.
Cell, 137(3), 560-570 (2009-05-05)
Sirtuins are NAD-dependent protein deacetylases that connect metabolism and aging. In mammals, there are seven sirtuins (SIRT1-7), three of which are associated with mitochondria. Here, we show that SIRT5 localizes in the mitochondrial matrix and interacts with carbamoyl phosphate synthetase
Xiao-bin Lv et al.
Scientific reports, 5, 17940-17940 (2015-12-15)
SUN2, a key component of LINC (linker of nucleoskeleton and cytoskeleton) complex located at the inner nuclear membrane, plays unknown role in lung cancer. We found that SUN2 expression was decreased in lung cancer tissue compared with paired normal tissues

Náš tým vědeckých pracovníků má zkušenosti ve všech oblastech výzkumu, včetně přírodních věd, materiálových věd, chemické syntézy, chromatografie, analytiky a mnoha dalších..

Obraťte se na technický servis.