SAB1405350

Monoclonal Anti-SP7 antibody produced in mouse

clone 1C11, purified immunoglobulin, buffered aqueous solution

• Sinónimos: MGC126598, OSX, osterix
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1C11, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~34.47 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_152860
• Nº de acceso UniProt: Q8TDD2
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SP7(121340)

Descripción

Descripción general

SP7 is a C2H2-type zinc finger transcription factor of the SP gene family and a putative master regulator of bone cell differentiation (Gao et al., 2004 [PubMed 15474293]).[supplied by OMIM

Inmunógeno

SP7 (NP_690599, 87 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMH

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable