Passa al contenuto
Merck
Tutte le immagini(6)

Documenti fondamentali

WH0007528M1

Sigma-Aldrich

Monoclonal Anti-YY1 antibody produced in mouse

clone 2C4, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-DELTA, Anti-NFE1, Anti-UCRBP, Anti-YINYANG1, Anti-YY1 transcription factor

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μG
CHF 403.00

CHF 403.00


Spedizione prevista il14 aprile 2025



Scegli un formato

Cambia visualizzazione
100 μG
CHF 403.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

CHF 403.00


Spedizione prevista il14 aprile 2025


Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

2C4, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... YY1(7528)

Descrizione generale

The gene YY1 (Yin Yang 1) encodes a protein belonging to the GLI-Krüppel gene family. It is a zinc finger protein that is ubiquitously expressed. The YY1 gene is mapped to human chromosome 14q32.

Immunogeno

YY1 (NP_003394, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH

Applicazioni

Monoclonal Anti-YY1 antibody produced in mouse has been used in immunohistochemistry.

Azioni biochim/fisiol

YY1 (Yin Yang 1) is a transcriptional repressor protein encoded by the YY1 gene in humans. It regulates diverse biological processes and may have an important role in carcinogenesis. Its expression is found to be upregulated in gastric cancer cell lines and primary gastric cancers. YY1 is found to contribute to carcinogenesis in gastric cancer. This DNA-binding protein is found to regulate the activity of the c-fos promoter. YY1 has roles in cell proliferation, differentiation, apoptosis and cell cycle progression.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

YY1 DNA binding and interaction with YAF2 is essential for Polycomb recruitment
Arindam Basu
Nucleic Acids Research, 42 (2013)
Transcription factor YY1 expression in human gastrointestinal cancer cells
Dharmaraj Chinnappan
International Journal of Oncology, 34 (2009)
DNA bending and orientation-dependent function of YY1 in the c-fos promoter
S Natesan
Genes & Development, 7 (1993)
Transcriptional repression by YY1, a human GLI-Kruppel-related protein, and relief of repression by adenovirus E1A protein
Y Shi
Cell, 34 (2009)
Expression of YY1 in Differentiated Thyroid Cancer
Jessica Arribas
Endocrine Pathology (2015)

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.