AV42475

Anti-PLUNC antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-LUNX, Anti-NASG, Anti-Palate, lung and nasal epithelium carcinoma associated, Anti-SPLUNC1, Anti-SPURT, Anti-bA49G10.5
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 28 kDa
• Reattività contro le specie: guinea pig, goat, rat, bovine, human, dog, mouse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_570913
• N° accesso UniProt: Q9NP55
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PLUNC(51297)

Descrizione

Descrizione generale

PLUNC-like proteins display sequence homology with BPI (bactericidal/permeability-increasing protein) is a 456-residue cationic protein shown to possess both bactericidal and LPS (lipopolysaccharide)-binding activities. Palate, lung and nasal epithelium carcinoma associated/secretory protein in upper respiratory tracts (PLUNC, LUNX, NASG, SPURT, SPLUNC1) appears to support antimicrobial and anti-inflammatory functions in Gram-negative bacteria-induced respiratory infection.

Specificità

Anti-PLUNC polyclonal antibody reacts with human, mouse, rat, pig, canine, and bovine PLUNC1 proteins.

Immunogeno

Synthetic peptide directed towards the middle region of human PLUNC

Applicazioni

Anti-PLUNC polyclonal antibody is used to tag palate, lung and nasal epithelium carcinoma associated/secretory protein in upper respiratory tracts (PLUNC1) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of palate, lung and nasal epithelium carcinoma associated/secretory protein in upper respiratory tracts in defense against Gram-negative bacterial-induced respiratory infection.

Azioni biochim/fisiol

PLUNC is the human homolog of murine plunc and is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this protein is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this gene is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3′ UTR have been detected, but the full-length nature of only two is known.

Sequenza

Synthetic peptide located within the following region: GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable