Accéder au contenu
Merck
Toutes les photos(11)

Principaux documents

HPA019947

Sigma-Aldrich

Anti-RUVBL1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-49 kDa TATA box-binding protein-interacting protein, Anti-49 kDa TBP-interacting protein, Anti-ECP-54, Anti-INO80 complex subunit H, Anti-NMP 238, Anti-Pontin 52, Anti-RuvB-like 1, Anti-TAP54-alpha, Anti-TIP49a

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
481.00 CHF

481.00 CHF


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μL
481.00 CHF

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.43

481.00 CHF


Check Cart for Availability

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

independent
RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500

Séquence immunogène

GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... RUVBL1(8607)

Description générale

RUVBL1 (RuvB-like AAA ATPase 1) is a 50kDa protein belonging to the AAA(+)-family of ATPases (ATPase associated with diverse cellular activities). It is composed of three functional domains, named as (DI, DII, and DIII domains. DII domain consists of 6 α-helices, 9 β-strands, and 2 very short 310-helices. Among all the domains, two domains are responsible for ATP binding and hydrolysis.[1]

Immunogène

RuvB-like 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-RUVBL1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

RUVBL1 (RuvB-like AAA ATPase 1) is involved in various cellular processes including transcriptional regulation, DNA replication, DNA damage repair, chromatin remodeling and apoptosis. In the chromatin-remodeling process, it conjugates with other proteins to form the human histone acetylase/chromatin-remodeling complex TIP60, which plays an essential role in transcription and DNA repair. The chromatin-remodeling complex regulates chromatin structure as well as it maintains DNA-based export in the cell. It also functions as a component of the human RNA polymerase II holoenzyme complex, which indicates its role in transcriptional processes. RUVBL1 is also associated with two oncogenic pathways, c-Myc and another, β-catenin pathways. In addition, it also performs in small nucleolar ribonucleoprotein particle assembly, nucleolar localization, and trafficking.[1]

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST74004

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Reticulocytes Are an Enriched Source of the RUVBL1 Protein.
Beverly W Baron et al.
Acta haematologica, 138(3), 162-165 (2017-10-06)
Beverly W Baron et al.
Biochemistry and biophysics reports, 6, 1-8 (2016-04-12)
The human BCL6 gene, which is involved in the pathogenesis of certain human lymphomas, encodes a transcriptional repressor that is needed for germinal center B cell development and T follicular helper cell differentiation. Our goal was to identify BCL6 target
Keisuke Taniuchi et al.
International journal of oncology, 44(6), 1945-1954 (2014-04-15)
We report a novel function of RUVBL1 molecule in pancreatic cancer cells. Previous reports describe that RUVBL1 belongs to the family of AAA+ ATPases that associate with chromatin-remodelling complexes and have important roles in transcriptional regulation, the DNA damage response
Mingli Li et al.
Advanced science (Weinheim, Baden-Wurttemberg, Germany), 10(17), e2206584-e2206584 (2023-04-20)
Epigenetic dysregulation is reported in multiple cancers including Ewing sarcoma (EwS). However, the epigenetic networks underlying the maintenance of oncogenic signaling and therapeutic response remain unclear. Using a series of epigenetics- and complex-focused CRISPR screens, RUVBL1, the ATPase component of
Jirina Tyleckova et al.
International journal of molecular sciences, 13(12), 15536-15564 (2013-02-28)
A comprehensive proteome map of T-lymphoblastic leukemia cells and its alterations after daunorubicin, doxorubicin and mitoxantrone treatments was monitored and evaluated either by paired comparison with relevant untreated control and using multivariate classification of treated and untreated samples. With the

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique