Direkt zum Inhalt
Merck

SRP0158

Sigma-Aldrich

Histone H3 (2-58) human

recombinant, expressed in E. coli, ≥70% (SDS-PAGE)

Synonym(e):

HIST1H3E, Histone H3.1

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

500 μG
CHF 485.00

CHF 485.00


Voraussichtliches Versanddatum11. April 2025


Bulk-Bestellung anfordern

Größe auswählen

Ansicht ändern
500 μG
CHF 485.00

About This Item

UNSPSC-Code:
12352200
NACRES:
NA.32

CHF 485.00


Voraussichtliches Versanddatum11. April 2025


Bulk-Bestellung anfordern

Biologische Quelle

human

Rekombinant

expressed in E. coli

Assay

≥70% (SDS-PAGE)

Form

aqueous solution

Mol-Gew.

32 kDa

Verpackung

pkg of 500 μg

Lagerbedingungen

avoid repeated freeze/thaw cycles

Konzentration

>0.02 mg/mL

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

dry ice

Lagertemp.

−70°C

Angaben zum Gen

human ... HIST1H3E(8353)

Allgemeine Beschreibung

The mammalian chromatin is present in nucleosomes, made of histone octamers (H2A,H2B,H3,H4)2. Mammals contain three main classes of histone H3 variants: the replicative histones (H3.1 and H3.2), the replacement histone (H3.3) and the centromeric histone (Cenp-A).[1][2][3]
Human Histone 3 (GenBank Accession No. NM_003532), (amino acid 2-58) with N-terminal GST tag, MW = 32kDa, expressed in an Escherichia coli expression system.

Anwendung

Suitable substrate for histone methyltransferases

Biochem./physiol. Wirkung

Histone proteins are basic building blocks of chromatin.[4] H3.1 (also referred to as HIST1H3E) is mainly expressed in the S phase and is termed as replication-dependent histone.[5] Selective methylation of H3.1 controls replication in heterochromatin area.[6]

Physikalische Form

Formulated in 25 mM Tris-HCl, pH 8.0, 100 mM NaCl, 0.05% Tween-20, 20% glycerol and 3 mM DTT.

Angaben zur Herstellung

Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot enzyme into single use aliquots. Store remaining undiluted enzyme in aliquots at -70°C. Note: Enzyme is very sensitive to freeze/thaw cycles.

Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Selective methylation of histone H3 variant H3.1 regulates heterochromatin replication.
Jacob Y, et al.
Science, 343, 1249-1249 (2014)
Topography of the histone octamer surface: repeating structural motifs utilized in the docking of nucleosomal DNA.
Arents G and Moudrianakis EN
Proceedings of the National Academy of Sciences of the USA, 90, 10489-10489 (1993)
Genome-wide analysis of histone H3 lysine 4 trimethylation in peripheral blood mononuclear cells of minimal change nephrotic syndrome patients.
Zhang L, et al.
American Journal of Nephrology, 30, 505-505 (2009)
Eric I Campos et al.
Nature structural & molecular biology, 17(11), 1343-1351 (2010-10-19)
The mechanism by which newly synthesized histones are imported into the nucleus and deposited onto replicating chromatin alongside segregating nucleosomal counterparts is poorly understood, yet this program is expected to bear on the putative epigenetic nature of histone post-translational modifications.
Signaling to chromatin through histone modifications.
P Cheung et al.
Cell, 103(2), 263-271 (2000-11-01)

Questions

1–2 of 2 Questions  
  1. What is the amino acid sequence of Histone H3 (2-58) human, product SRP0158?

    1 answer
    1. The sequence for product SRP0158, Histone H3 (2-58) human, is as follows:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS

      Helpful?

  2. What is the Department of Transportation shipping information for this product?

    1 answer
    1. Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.

      Helpful?

Reviews

No rating value

Active Filters

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.