SAB5702342

[KO Validated]Anti-STAT2 Antibody, clone 4A5P8, Rabbit Monoclonal

• Synonym(e): IMD44, ISGF-3, P113, STAT113
• UNSPSC-Code: 12352203
• NACRES: NA.46

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Materialien: colorless
• Klon: 4A5P8, monoclonal
• Form: liquid
• Speziesreaktivität: human, rat
• Konzentration: 1 mg/mL
• Methode(n): western blot: 1:500 - 1:2000
• Farbe: colorless
• Isotyp: IgG
• Immunogene Sequenz: KLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDEL
• UniProt-Hinterlegungsnummer: P52630
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... STAT2(6773)

Beschreibung

Allgemeine Beschreibung

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. Transcription adaptor P300/CBP (EP300/CREBBP) has been shown to interact specifically with this protein, which is thought to be involved in the process of blocking IFN-alpha response by adenovirus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]

Immunogen

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 550-706 of human STAT2 (NP_005410.1).

Anwendung

WB

Sicherheitshinweise

• Piktogramme: GHS07,GHS09
• Signalwort: Warning
• H-Sätze: H317,H411
• P-Sätze: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Gefahreneinstufungen: Aquatic Chronic 2 - Skin Sens. 1
• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3