SAB2104243
Anti-TRPV4 antibody produced in rabbit
affinity isolated antibody
Synonym(e):
Anti-OTRPC4, Anti-TRP12, Anti-VR-OAC, Anti-VRL2
Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise
Größe auswählen
100 μL
CHF 473.00
CHF 473.00
Check Cart for Availability
Alle Fotos(4)
Größe auswählen
Ansicht ändern
100 μL
CHF 473.00
About This Item
CHF 473.00
Check Cart for Availability
Empfohlene Produkte
Biologische Quelle
rabbit
Qualitätsniveau
Konjugat
unconjugated
Antikörperform
affinity isolated antibody
Antikörper-Produkttyp
primary antibodies
Klon
polyclonal
Form
buffered aqueous solution
Mol-Gew.
91 kDa
Speziesreaktivität
human, rabbit
Konzentration
0.5 mg - 1 mg/mL
Methode(n)
immunohistochemistry: suitable
western blot: suitable
NCBI-Hinterlegungsnummer
UniProt-Hinterlegungsnummer
Versandbedingung
wet ice
Lagertemp.
−20°C
Posttranslationale Modifikation Target
unmodified
Angaben zum Gen
human ... TRPV4(59341)
Immunogen
Synthetic peptide directed towards the middle region of human TRPV4
Biochem./physiol. Wirkung
TRPV4 is a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. TRPV4 is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure.This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Two transcript variants encoding different isoforms have been found for this gene.
Sequenz
Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Sie haben nicht das passende Produkt gefunden?
Probieren Sie unser Produkt-Auswahlhilfe. aus.
Lagerklassenschlüssel
10 - Combustible liquids
WGK
WGK 3
Flammpunkt (°F)
Not applicable
Flammpunkt (°C)
Not applicable
Hier finden Sie alle aktuellen Versionen:
Analysenzertifikate (COA)
Lot/Batch Number
Die passende Version wird nicht angezeigt?
Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Lei Shi et al.
Pharmaceutical biology, 61(1), 1000-1012 (2023-07-06)
Hyperoside (Hyp), one of the active flavones from Rhododendron (Ericaceae), has beneficial effects against cerebrovascular disease. However, the effect of Hyp on vasodilatation has not been elucidated. To explore the effect of Hyp on vasodilatation in the cerebral basilar artery
Kathia Beddek et al.
Physiological reports, 9(3), e14613-e14613 (2021-01-30)
The Transient Receptor Potential Vanilloid 4 (TRPV4) of endothelial cells contributes to many important functions including the regulation of Ca2+ homeostasis, cell volume, endothelial barrier permeability, and smooth muscle tone. However, its role in the transition of endothelial cells toward
Barbara Barile et al.
Frontiers in cellular neuroscience, 17, 1247761-1247761 (2023-09-18)
Despite of the major role of aquaporin (AQP) water channels in controlling transmembrane water fluxes, alternative ways for modulating water permeation have been proposed. In the Central Nervous System (CNS), Aquaporin-4 (AQP4) is reported to be functionally coupled with the
Yan Zhang et al.
American journal of physiology. Gastrointestinal and liver physiology, 303(12), G1365-G1372 (2012-10-23)
Transient receptor potential vanilloid subtype 4 (TRPV4) is a ligand-gated nonselective cation channel that participates in the transduction of mechanical and osmotic stimuli in different tissues. TRPV4 is activated by endogenous arachidonic acid metabolites, 4α-phorbol-12,13 didecanoate, GSK1016790A, moderate heat, and
S Fu et al.
Osteoarthritis and cartilage, 29(1), 89-99 (2021-01-05)
Cartilage health is maintained in response to a range of mechanical stimuli including compressive, shear and tensile strains and associated alterations in osmolality. The osmotic-sensitive ion channel Transient Receptor Potential Vanilloid 4 (TRPV4) is required for mechanotransduction. Mechanical stimuli inhibit
Active Filters
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung.
