SAB2102838

Anti-ZNF263 (ab2) antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-FPM315, Anti-ZKSCAN12, Anti-Zinc finger protein 263
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 77 kDa
• Speziesreaktivität: horse, bovine, dog, human, rabbit, guinea pig
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• UniProt-Hinterlegungsnummer: O14978
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ZNF263(10127)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human ZNF263

Biochem./physiol. Wirkung

ZNF263 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers, 1 KRAB domain and 1 SCAN box domain. ZNF263 might play an important role in basic cellular processes as a transcriptional repressor.

Sequenz

Synthetic peptide located within the following region: CHECGDSFSHSSNRIRHLRTHTGERPYKCSECGESFSRSSRLMSHQRTHT

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable