HPA017732

Anti-CNNM4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Ancient conserved domain- containing protein 4, Anti-Cyclin-M4, Anti-Metal transporter CNNM4
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA017732
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunohistochemistry: 1:200- 1:500
• Immunogene Sequenz: FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSL
• UniProt-Hinterlegungsnummer: Q6P4Q7
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CNNM4(26504)

Beschreibung

Allgemeine Beschreibung

Ancient conserved domain-containing protein 4 (CNNM4) contains a highly conserved domain which is evolutionarily conserved from bacteria to mammals. In total, it has four transmembrane domains. CNNM4 is expressed in the gastrointestinal tract, neural retina and ameloblasts of the developing tooth. The gene encoding it is present on chromosome 2q11.

Immunogen

cyclin and CBS domain divalent metal cation transport mediator 4

Anwendung

Anti-CNNM4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

Ancient conserved domain-containing protein 4 (CNNM4) is involved in metal ion transport. It may remove unwanted Mg²⁺ ions which interfere with crystal formation in enamel and thus maintain the serum Mg²⁺ levels. In the epithelium, CNNM4 expels intracellular Mg²⁺ outside the cells in exchange for Na⁺. It binds to the enzyme phosphatase of regenerating liver (PRL) which is up-regulated in malignant human cancers. Along with PRL, CNNM4 is involved in energy metabolism and 5′ AMP-activated protein kinase (AMPK)/ mechanistic target of rapamycin (mTOR) signaling. Mutations in CNNM4 have been shown to be associated with recessive cone-rod dystrophy and amelogenesis imperfecta (Jalili syndrome).

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST73140

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)