HPA004935

Anti-CLEC4E antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-C-type lectin domain family 4, member E, Anti-CLECSF9, Anti-mincle
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA004935
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: SCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRI
• UniProt-Hinterlegungsnummer: Q9ULY5
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CLEC4E(26253)

Beschreibung

Allgemeine Beschreibung

CLEC4E (C-type lectin domain family 4, member E) belongs to C-type lectin receptors, which is a family of pattern recognition receptors. C-type lectin receptor family has more than 1000 members and includes any protein which has one or more C-type lectin-like domain (CLTD). CLEC4E, also called mincle, is a type II transmembrane protein, which is 219 aa long and has a highly conserved CLTD. CLEC4E is located on human chromosome 12 within the natural killer (NK) gene complex, which also includes BDCA-2, DCAR, DCIR, Dectin-2, and Clecsf8. CLEC4E protein has a single transmembrane domain, a short N- terminal cytoplasmic domain and a C-terminal extracellular C-type lectin carbohydrate recognition domain.

Immunogen

C-type lectin domain family 4, member E recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

CLEC4E (C-type lectin domain family 4, member E) recognises the glycolipid trehalose-6,6-dimycolate (TDM, also called cord factor) present in Mycobacterium species, pathogenic fungi Malassezia spp., and spliceosome-associated protein 130 (SAP130), which is an endogenous ligand released during cell necrosis. Upon sensing damaged cells, Mincle induces activated macrophages to produce inflammatory cytokines. It plays an important role in the immunological response against Candida albicans infections in mammals. It is also responsible for the inflammation in lupus nephritis, by interacting with SAP130 present in necrotic cell debris and promoting the production of inflammatory cytokines. CLEC4E, in coordination with CLEC4D, helps to control bacterial growth and hyperinflammation in bacterial pneumonia and chronic lung diseases, by regulating phagocytosis and efferocytosis. It also has functions in or has relevance to diseases such as connective tissue disorder, rheumatic disease, arthritis, skeletal and muscular disorder etc.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST70024

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable