Synthetic peptide directed towards the N terminal region of human ZDHHC16
Anwendung
Anti-ZDHHC16 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem./physiol. Wirkung
Zinc finger, DHHC-type containing 16 (ZDHHC16; APH2; DHHC-16) is c-Abl interacting protein that is localized to endoplasmic reticulum. It may be involved in ER stress-induced apoptosis and exhibit pro-apoptotic activity. It may also interact with JAB1 protein and negatively regulate the activation of AP-1.
Sequenz
Synthetic peptide located within the following region: SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Sorafenib is currently the first-line treatment for advanced hepatocellular carcinoma (HCC). However, sorafenib resistance remains a significant challenge. Aberrant AKT signaling activation is a crucial mechanism driving sorafenib resistance in HCC. Proprotein convertase subtilisin/kexin type 9 (PCSK9) plays a vital
The Journal of biological chemistry, 277(32), 28870-28876 (2002-05-22)
c-Abl is a non-receptor tyrosine kinase implicated in DNA damage-induced cell death and in growth factor receptor signaling. To further understand the function and regulation of c-Abl, a yeast two-hybrid screen was performed to identify c-Abl-interacting proteins. Here we report
Biochimica et biophysica acta, 1759(11-12), 514-525 (2006-11-25)
A human Aph2 gene (hAph2) was identified and cloned from a human placenta cDNA library. Bioinformatics analysis revealed hAPH2 protein shares 96% identity with mouse APH2 and contains a zf-DHHC domain (148-210aa), which is always involved in protein-protein or protein-DNA
Questions
Reviews
★★★★★ No rating value
Active Filters
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..