HPA011165

Anti-SIRT2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-NAD-dependent deacetylase sirtuin-2, Anti-SIR2-like, Anti-SIR2-like protein 2
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA011165
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• Séquence immunogène: KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL
• Numéro d'accès UniProt: Q8IXJ6
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SIRT2(22933)

Description

Description générale

SIRT2 (sirtuin 2) is a member of a highly conserved protein family called sirtuins. In humans, there are 7 members in this family, from sirtuin1-7. This gene is localized to human chromosome 19q13.2. SIRT2 protein has a helical N-terminal made of 19 amino acids, and a catalytic core made of 304 amino acids. The core region consists of two domains- the larger domain contains a Rossmann fold variant, and the smaller domain contains a zinc atom. This protein resides in the cytoplasm. However, studies show that an alternatively spliced variant of SIRT2, isoform 5, lacks a nuclear export signal and is constitutively localized to the nucleus.

Immunogène

NAD-dependent deacetylase sirtuin-2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

SIRT2 (sirtuin 2) is an NAD⁺ (nicotinamide adenine dinucleotide)-dependent deacetylase which uses tubulin as its substrate. It is implicated in monitoring mitosis and normal progression of cell cycle. It might be involved in cell cycle checkpoint, and respond to mitotic stress. It prevents chromosomal condensation in response to mitotic stress and thus maintains chromosomal stability. This protein is down-regulated in gliomas, and might act as a tumor suppressor by modulating microtubule network. Studies show that SIRT2 is implicated in the anti-proliferative effects of resveratrol on human glioblastoma stem cells, and therefore, might have potential as a therapeutic target. In neurons with oxidative stress, down-regulation of SIRT2 is responsible for modified microtubule dynamics due to alterations in tubulin deacetylation. Therefore, it might be implicated in Parkinson′s disease. Meta-analysis shows that SNP in this gene is involved in the pathogenesis of Alzheimer′s disease with APOE ε4 status.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71542

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)