Accéder au contenu
MilliporeSigma
Toutes les photos(5)

Documents

HPA005468

Sigma-Aldrich

Anti-ASAH1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-AC, Anti-Acid ceramidase precursor, Anti-Acylsphingosine deacylase, Anti-N-acylsphingosine amidohydrolase, Anti-PHP32, Anti-Putative 32 kDa heart protein

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

Séquence immunogène

ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ASAH1(427)

Description générale

N-acylsphingosine amidohydrolase (ASAH1) gene is located on human chromosome 8p22-21.2. It is a 26.5kb long gene, which has 14 exons and 13 introns. This gene codes for a 55kDa protein with two subunits- 13kDa α and 40kDa β subunits. It is a glycoprotein and the two subunits are produced by auto-proteolytic cleavage. This protein is highly expressed in heart, lung, kidney and placenta and is expressed to a lesser extent in brain, liver, pancreas and skeletal muscle. ASAH1 is localized to lysosomes and human fibroblasts and macrophages secrete it extracellularly.

Immunogène

Acid ceramidase precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-ASAH1 antibody is suitable for chromatin immunoprecipitation (ChIP) and reChIP.
Anti-ASAH1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

N-acylsphingosine amidohydrolase (ASAH1) converts ceramide to fatty acid and sphingosine. ASAH1 deficiency leads to Farber disease (FD) or Farber lipogranulomatosis, which is a lysosomal storage disease. It is characterized by pulmonary insufficiency, painful swelling of joints and tendons, and a shortened life-span, because of the accumulation of ceramide in tissues. It regulates adrenocortical steroidogenesis by maintaining the intracellular balance of ceramide, sphingosine and sphingosine-1-phosphate. These molecules in turn act as second messengers in protein kinase A/cAMP-dependent pathway mediated steroidogenesis. Expression of ASAH1 is found to be elevated in multiple tumor types, especially prostate cancer. Studies suggest that ASAH1 is a potential therapeutic target in chemoresistant and advanced prostate cancer types.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST70303

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Luz Camacho et al.
Journal of lipid research, 54(5), 1207-1220 (2013-02-21)
Acid ceramidase (AC) catalyzes the hydrolysis of ceramide into sphingosine, in turn a substrate of sphingosine kinases that catalyze its conversion into the mitogenic sphingosine-1-phosphate. AC is expressed at high levels in several tumor types and has been proposed as
Z Zhang et al.
Molecular genetics and metabolism, 70(4), 301-309 (2000-09-20)
Farber disease is an autosomal recessive disorder caused by lysosomal acid ceramidase (AC) deficiency. It commonly manifests during the first few months after birth with a unique triad of painful and progressive deformed joints, subcutaneous nodules, and progressive hoarseness. In
J Koch et al.
The Journal of biological chemistry, 271(51), 33110-33115 (1996-12-20)
Human acid ceramidase ((AC) N-acylsphingosine amidohydrolase, EC 3.5. 1.23) hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid. Ceramide is an essential component of all sphingolipids and an important cell-signaling molecule. Moreover, an inherited deficiency of AC activity leads
C M Li et al.
Genomics, 62(2), 223-231 (1999-12-28)
Acid ceramidase (AC) is the lysosomal enzyme that degrades ceramide into sphingosine and fatty acid. A deficiency in human AC activity leads to the lysosomal storage disorder, Farber disease (FD). The human AC gene (HGMW-approved symbol ASAH) was cloned and
Jennifer J Hill et al.
Journal of proteome research, 14(3), 1376-1388 (2015-02-07)
Triple-negative (TN) breast cancer accounts for ∼ 15% of breast cancers and is characterized by a high likelihood of relapse and a lack of targeted therapies. In contrast, luminal-type tumors that express the estrogen and progesterone receptors (ER+/PR+) and lack

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique