Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

WH0055145M1

Sigma-Aldrich

Monoclonal Anti-THAP1 antibody produced in mouse

clone 2C1-2F2, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-FLJ10477, Anti-MGC33014, Anti-THAP domain containing, apoptosis associated protein 1

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μG
R$ 3.068,00

R$ 3.068,00

Check Cart for Availability
Todas as fotos(4)

Selecione um tamanho

Alterar visualização
100 μG
R$ 3.068,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 3.068,00

Check Cart for Availability

fonte biológica

mouse

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

2C1-2F2, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

human

técnica(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2bκ

nº de adesão GenBank

BC021721

nº de adesão UniProt

Q9NVV9

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... THAP1(55145)

Descrição geral

THAP domain containing 1 (THAP1) is a transcription factor encoded by the gene mapped to human chromosome 18p11.21. The encoded protein contains an N-terminal conserved DNA-binding domain, designated THAP domain with a zinc-finger structure.

Imunogênio

THAP1 (AAH21721, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA

Ações bioquímicas/fisiológicas

THAP domain containing 1 (THAP1) plays a key role in endothelial cell proliferation and pro-apoptotic processes. Mutation in the gene is associated with primary dystonia type 6 (DYT6). The encoded protein links prostate-apoptosis-response-4 (Par-4) to promyelocytic leukemia (PML) nuclear bodies, which facilitates both serum withdrawal and tumor necrosis factor-α (TNF-α)-induced apoptosis.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

nwg

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
07299-S1

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Screening for THAP1 Mutations in Polish Patients with Dystonia Shows Known and Novel Substitutions.
Golanska E
PLoS ONE, 10(6), e0129656-e0129656 (2015)
Intrafamilial variability of the primary dystonia DYT6 phenotype caused by p.Cys5Trp mutation in THAP1 gene.
Jurek M, et.al
Neurologia i Neurochirurgia Polska, 48(4), 254-257 (2014)
Interaction between variants of two glycosyltransferase genes in IgA nephropathy.
Zhu L, et.al
Kidney International, 76(2), 190-198 (2009)
Marta Jurek et al.
Neurologia i neurochirurgia polska, 48(4), 254-257 (2014-08-30)
Mutations localized in THAP1 gene, locus 18p11.21 have been reported as causative of primary dystonia type 6 (DYT6). Disease which is characterized mainly by focal dystonia, frequently involving the craniocervical region, however associated also with early-onset generalized dystonia and spasmodic
Li Zhu et al.
Kidney international, 76(2), 190-198 (2009-04-10)
Increasing evidence points to the importance of aberrant O-glycosylated immunoglobulin A1 (IgA1) in the pathogenesis of IgA nephropathy (IgAN), a disease widely considered to be a polygenic disorder. We earlier found that haplotypes in two key glycosyltransferase genes, C1GALT1 and

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica