Pular para o conteúdo
Merck
Todas as fotos(1)

Key Documents

WH0005741M5

Sigma-Aldrich

Monoclonal Anti-PTH antibody produced in mouse

clone 4A2, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-parathyroid hormone

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

4A2, monoclonal

forma

buffered aqueous solution

reatividade de espécies

human

técnica(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable

Isotipo

IgG2aκ

nº de adesão GenBank

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... PTH(5741)

Descrição geral

Parathyroid hormone (PTH) is a polypeptide hormone, synthesized via parathyroid gland. The 84 amino acid PTH protein is processed by Kupffer cells of the liver to give an N-terminal fragment (PTH 1-37) and a C-terminal fragment (PTH 38-84). The N-terminal fragment is crucial for the biological functions. The gene encoding PTH is localized on human chromosome 11p15.

Imunogênio

PTH (NP_000306, 32 a.a. ~ 115 a.a) recombinant protein.

Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Ações bioquímicas/fisiológicas

Parathyroid hormone (PTH) is a parathyroid-secreted polypeptide hormone that increases the level of calcium in blood by enhancing calcium mobilization from bone. It also increases the calcium: phosphate ratio in the kidney and promotes the absorption of calcium by the intestines. PTH acts as an anabolic agent that improves osteoblastic bone development.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Alendronate inhibits PTH (1-34)-induced bone morphogenetic protein expression in MC3T3-E1 preosteoblastic cells.
Issack PS
HSS Journal : The Musculoskeletal Journal of Hospital for Special Surgery (2007)
Renal control of calcium, phosphate, and magnesium homeostasis.
Blane J
Clinical journal of the American Society of Nephrology : CJASN (2015)
Parathyroid hormone induces adipocyte lipolysis via PKA-mediated phosphorylation of hormone-sensitive lipase.
Larsson S
Cellular Signalling (2016)
Chromosome mapping of genes on the short arm of human chromosome 11: parathyroid hormone gene is at 11p15 together with the genes for insulin, c-Harvey-ras 1, and beta-hemoglobin.
Cytogenetics and Cell Genetics (1985)
Sirtuin 1 is a negative regulator of parathyroid hormone stimulation of matrix metalloproteinase 13 expression in osteoblastic cells: role of sirtuin 1 in the action of PTH on osteoblasts.
Fei Y
The Journal of Biological Chemistry (2015)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica