WH0005741M5

Monoclonal Anti-PTH antibody produced in mouse

clone 4A2, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-parathyroid hormone
• Número MDL: MFCD01324156
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4A2, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• nº de adesão GenBank: N/A
• nº de adesão UniProt: P01270
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PTH(5741)

Descrição

Descrição geral

Parathyroid hormone (PTH) is a polypeptide hormone, synthesized via parathyroid gland. The 84 amino acid PTH protein is processed by Kupffer cells of the liver to give an N-terminal fragment (PTH 1-37) and a C-terminal fragment (PTH 38-84). The N-terminal fragment is crucial for the biological functions. The gene encoding PTH is localized on human chromosome 11p15.

Imunogênio

PTH (NP_000306, 32 a.a. ~ 115 a.a) recombinant protein.

Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Ações bioquímicas/fisiológicas

Parathyroid hormone (PTH) is a parathyroid-secreted polypeptide hormone that increases the level of calcium in blood by enhancing calcium mobilization from bone. It also increases the calcium: phosphate ratio in the kidney and promotes the absorption of calcium by the intestines. PTH acts as an anabolic agent that improves osteoblastic bone development.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)