WH0004780M1

Monoclonal Anti-NFE2L2 antibody produced in mouse

clone 1F3, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-NRF2, Anti-nuclear factor (erythroid-derived 2)-like 2
• Código UNSPSC: 12352203

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1F3, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: suitable
• Isotipo: IgG2bκ
• sequência de imunogênio: FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA (without GST)
• nº de adesão UniProt: Q16236
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... NFE2L2(4780)

Descrição

Imunogênio

NFE2L2 (AAH11558, a.a. 71-170) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.

forma física

Solution in phosphate buffered saline, pH 7.2

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)