WH0000962M1

Monoclonal Anti-CD48 antibody produced in mouse

clone 3B8-2C2, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-BCM1, Anti-BLAST, Anti-BLAST1, Anti-CD48 antigen (B-cell membrane protein), Anti-MEM102, Anti-SLAMF2, Anti-hCD48, Anti-mCD48
• Número MDL: MFCD00239660
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3B8-2C2, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: BC030224
• nº de adesão UniProt: P09326
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CD48(962)

Descrição

Descrição geral

BLAST1 is the designation used for an activation-associated cell surface glycoprotein of 40 to 45 kD expressed primarily in mitogen-stimulated human lymphocytes. The protein sequence predicted by the cDNA encoding BLAST1 indicates that BLAST1 is a member of the immunoglobulin supergene family. Yokoyama (1991) identified the BLAST1 activation/adhesion molecule as CD48.[supplied by OMIM

Imunogênio

CD48 (AAH30224, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGEEERKTSGQV

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)