WH0000546M1

Anti-ATRX Antibody

mouse monoclonal, 3C9

• Sinônimo(s): Anti-ATR2, Anti-MGC2094, Anti-MRXS3, Anti-RAD54, Anti-RAD54L, Anti-SHS, Anti-XH2, Anti-XNP, Anti-ZNFHX, Anti-alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae)
• Número MDL: MFCD03791982
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• Nome do produto: Monoclonal Anti-ATRX antibody produced in mouse, clone 3C9, purified immunoglobulin, buffered aqueous solution
• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3C9, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• nº de adesão GenBank: NM_000489
• nº de adesão UniProt: P46100
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ATRX(546)

Descrição

Descrição geral

The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. (provided by RefSeq)

Imunogênio

ATRX (NP_000480, 2311 a.a. ~ 2410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILM

Características e benefícios

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)