WH0000323M1

Monoclonal Anti-APBB2 antibody produced in mouse

clone 2D8, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-FE65L, Anti-FE65L1, Anti-MGC35575, Anti-amyloid beta (A4) precursor protein-binding, family B, member 2 (Fe65-like)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2D8, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• nº de adesão GenBank: BC027946
• nº de adesão UniProt: Q92870
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... APBB2(323)

Descrição

Descrição geral

The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction. (provided by RefSeq)

Imunogênio

APBB2 (AAH27946, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLV

Ações bioquímicas/fisiológicas

The gene APBB2 (amyloid β precursor protein binding family B member 2), also referred to as FE65-like 1, encodes an adaptor protein that binds to the cytoplasmic domain of β-amyloid precursor protein (βAPP) and processes it to form β-amyloid (Aβ). Over-expression of APBB2 leads to an accumulation of Aβ in senile plaques seen in patients with Alzheimer′s disease (AD). Mutations in this gene have been associated with AD.

Características e benefícios

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)