SAB2108885

Anti-IL1B (N-terminal) antibody produced in rabbit HRP conjugated

affinity isolated antibody

• Sinônimo(s): MFSD2, NLS1
• Código UNSPSC: 12352203
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• conjugado: peroxidase conjugate
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 17 kDa
• reatividade da espécie (prevista por homologia): rabbit, mouse, human, horse, canine
• concentração: 0.5 mg/mL
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL
• nº de adesão NCBI: NM_000576
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... IL1B(3553)

Descrição

Descrição geral

IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.

Imunogênio

Synthetic peptide directed towards the N terminal region of human IL1B

Sequência

Synthetic peptide located within the following region: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL

forma física

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable