Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos

SAB2108573

Sigma-Aldrich

Anti-GLS2

IgG fraction of antiserum

Sinônimo(s):

Anti- GLS, Anti- LGA, Anti- MGC71567, Anti- hLGA, Anti-GA

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

36 kDa

reatividade de espécies

rat, horse, mouse, human, dog, pig

concentração

0.5-1 mg/mL

técnica(s)

immunoblotting: suitable
immunohistochemistry: suitable

nº de adesão

NM_013267

nº de adesão UniProt

Q9UI32

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... GLS2(27165)

Descrição geral

Glutaminase 2 (GLS2) is located in mitochondria and nucleus. The gene is located on human chromosome 12q13. GLS2 protein is expressed in brain, pancreas, cancer cells and cells of the immune system.

Imunogênio

Synthetic peptide directed towards the middle region of human GLS2

Ações bioquímicas/fisiológicas

Glutaminase 2 (GLS2) is a mitochondrial phosphate-activated glutaminase that catalyses the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
GLS2 functions as a tumor protein p53 downstream target gene. GLS2 controls the functions of p53, in modulating energy metabolism and antioxidant defense. It might play a critical role in tumorigenesis. The protein negatively controls PI3K (phosphatidylinositol 3-kinase) /AKT (non-specific serine/threonine protein kinase) signalling pathway. GLS2 regulates the neuronal effects of tumor protein p73. The protein might have a pivotal role in radioresistance in cervical cancer patients.

Sequência

Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Knock-down of glutaminase 2 expression decreases glutathione, NADH, and sensitizes cervical cancer to ionizing radiation
Xiang L, et al.
Biochimica et Biophysica Acta (BBA)-Gene Structure and Expression, 1833(12), 2996-3005 (2013)
Expression of Gls and Gls2 glutaminase isoforms in astrocytes
Cardona C, et al.
Glia, 63(3), 365-382 (2015)
GLS2 is transcriptionally regulated by p73 and contributes to neuronal differentiation
Velletri T, et al.
Cell Cycle, 12(22), 3564-3573 (2013)
Mercedes Martín-Rufián et al.
PloS one, 7(6), e38380-e38380 (2012-06-09)
Glutaminase is expressed in most mammalian tissues and cancer cells, but the regulation of its expression is poorly understood. An essential step to accomplish this goal is the characterization of its species- and cell-specific isoenzyme pattern of expression. Our aim
Juan Liu et al.
Oncotarget, 5(9), 2635-2647 (2014-05-07)
The tumor suppressor p53 and its signaling pathway play a critical role in tumor prevention. As a direct p53 target gene, the role of glutaminase 2 (GLS2) in tumorigenesis is unclear. In this study, we found that GLS2 expression is

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica