Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos

SAB2106436

Sigma-Aldrich

Anti-EZH2 antibody produced in rabbit

affinity isolated antibody

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

85 kDa

reatividade de espécies

guinea pig, horse, dog, rat, bovine, rabbit, human, mouse

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

NM_001203247

nº de adesão UniProt

Q15910

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

Informações sobre genes

human ... EZH2(2146)

Imunogênio

Synthetic peptide directed towards the N terminal region of human EZH2

Ações bioquímicas/fisiológicas

EZH2 is a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems.

Sequência

Synthetic peptide located within the following region: KGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Ziming Li et al.
FEBS letters, 588(17), 3000-3007 (2014-06-15)
EZH2 is a key component of the polycomb PRC2 complex and functions as a histone H3 Lys27 (H3K27) trimethyltransferase. Here we show that EZH2 is down-regulated in human non-small cell lung cancer and low EZH2 expression predicts poor survival. Further
Shu-Qin Chen et al.
International journal of gynecological cancer : official journal of the International Gynecological Cancer Society, 24(9), 1653-1658 (2014-10-03)
The current study was undertaken to investigate the predictive value of simultaneous enhancer of zeste homolog 2 (EZH2) and P53 expression in lesions of patients with cervical squamous cell carcinoma. Quantum dot double fluorescence staining was applied to detect EZH2
Jurate Savickiene et al.
Anti-cancer drugs, 25(8), 938-949 (2014-05-08)
Therapeutic strategies targeting histone deacetylase (HDAC) inhibition have become promising in many human malignancies. Belinostat (PXD101) is a hydroxamate-type HDAC inhibitor tested in phase I and II clinical trials in solid tumors and hematological cancers. However, little is known about

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica