Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos

SAB2103221

Sigma-Aldrich

Anti-ATP6V0D2 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-ATP6D2, Anti-FLJ38708, Anti-VMA6

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

40 kDa

reatividade de espécies

mouse, human, guinea pig, dog, rabbit, rat

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

Descrição geral

Adenosine triphosphatase V0 (ATP6V0D2) is located on human chromosome 8q21. Atp6v0d2 is an isoform of vacuolar (H+) ATPase (v-ATPase) proton pump. ATP6V0D2 is expressed abundantly in mature osteoclasts.

Imunogênio

Synthetic peptide directed towards the middle region of human ATP6V0D2

Ações bioquímicas/fisiológicas

Adenosine triphosphatase V0 (ATP6V0D2) helps in osteoclast maturation and bone formation. Insulin activates ATP6V0D2 through extracellular-signal-regulated kinase (ERK)1/2 pathway.

Sequência

Synthetic peptide located within the following region: MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

v-ATPase V 0 subunit d2-deficient mice exhibit impaired osteoclast fusion and increased bone formation
Lee, Seou, et al.
Nature Medicine, 12(12), 1403-1403 (2006)
Insulin enhances RANKL-induced osteoclastogenesis via ERK1/2 activation and induction of NFATc1 and Atp6v0d2
Oh, Ju He, et al.
Cellular Signalling, 27(12), 2325-2331 (2015)
Integrated differential transcriptome maps of Acute Megakaryoblastic Leukemia (AMKL) in children with or without Down Syndrome (DS)
Pelleri,, et al.
BMC Medical Genomics, 7(1), 63-63 (2014)
Na Liu et al.
The Journal of clinical investigation, 129(2), 631-646 (2018-11-16)
Macrophages perform key functions in tissue homeostasis that are influenced by the local tissue environment. Within the tumor microenvironment, tumor-associated macrophages can be altered to acquire properties that enhance tumor growth. Here, we found that lactate, a metabolite found in
Weihao Zheng et al.
PLoS pathogens, 20(5), e1012205-e1012205 (2024-05-03)
Mycobacterium tuberculosis (Mtb) infects lung myeloid cells, but the specific Mtb-permissive cells and host mechanisms supporting Mtb persistence during chronic infection are incompletely characterized. We report that after the development of T cell responses, CD11clo monocyte-derived cells harbor more live

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica