SAB2102467

Anti-TMEM35 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-FLJ14084, Anti-Transmembrane protein 35
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 18 kDa
• reatividade de espécies: guinea pig, human, rabbit, horse, mouse, bovine, rat
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão UniProt: Q53FP2
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... TMEM35(59353)

Descrição

Descrição geral

Transmembrane protein 35 (TMEM35) is mostly expressed in hypothalamic-pituitary-adrenal (HPA) circuitry and limbic areas, including the hippocampus and amygdala of mice. TMEM35 sis also known as the unknown factor-1(TUF-1). Human TMEM35 consists of 167 amino acids and is located at human chromosome Xq22.

Imunogênio

Synthetic peptide directed towards the C terminal region of human TMEM35

Ações bioquímicas/fisiológicas

Transmembrane protein 35 (TMEM35) is a multi-pass membrane protein. Any alteration in Transmembrane protein 35 (TMEM35) causes long term memory loss as well as impairs behavioral functions. TMEM35 regulates cell cycle progression and thereby modulates osteosarcoma cell growth, migration and invasion, making it a potent drug development target for therapeutics. In zona glomerulosa, the neurite outgrowth after sodium depletion is regulated by TMEM35.

Sequência

Synthetic peptide located within the following region: VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable