HPA051870
Anti-TMEM119 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinônimo(s):
Tmem119 Antibody, Tmem119 Antibody - Anti-TMEM119 antibody produced in rabbit, Anti-transmembrane protein 119
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Produtos recomendados
fonte biológica
rabbit
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
linha de produto
Prestige Antibodies® Powered by Atlas Antibodies
forma
buffered aqueous glycerol solution
reatividade de espécies
human
validação aprimorada
independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
técnica(s)
immunohistochemistry: 1:500-1:1000
sequência de imunogênio
GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... TMEM119(338773)
Descrição geral
Transmembrane protein 119 (TMEM119) is encoded by the gene mapped to human chromosome 12q23.3. The encoded protein belongs to the transmembrane protein family. TMEM119 has an O-glycosylated N-terminal region.
Imunogênio
transmembrane protein 119 recombinant protein epitope signature tag (PrEST)
Aplicação
Anti-TMEM119 antibody produced in rabbit has been used in immunohistochemistry.
Ações bioquímicas/fisiológicas
Transmembrane protein 119 (TMEM119) acts as an osteoinductive factor and facilitates proliferation, migration and invasion of osteosarcoma cells.(28} It is a critical molecule acting downstream of the parathyroid hormone (PTH) and similar to mothers against decapentaplegic-3 (Smad3) signaling pathways in osteoblasts. TMEM119 is considered to be a potential microglial marker that differentiates resident microglia from blood-derived macrophages in the human brain. Mutation in the gene is associated with the development of osteosarcoma.
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST85802
forma física
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Tobias Zrzavy et al.
Brain : a journal of neurology, 140(7), 1900-1913 (2017-05-26)
Microglia and macrophages accumulate at the sites of active demyelination and neurodegeneration in the multiple sclerosis brain and are thought to play a central role in the disease process. We used recently described markers to characterize the origin and functional
Upregulation and biological function of transmembrane protein 119 in osteosarcoma.
Jiang Z H, et al.
Experimental & Molecular Medicine, 49(5), e329-e329 (2017)
Parathyroid hormone-responsive Smad3-related factor, Tmem119, promotes osteoblast differentiation and interacts with the bone morphogenetic protein-Runx2 pathway.
Hisa I, et al.
The Journal of Biological Chemistry, 286(11), 9787-9796 (2011)
Zhen-Huan Jiang et al.
Experimental & molecular medicine, 49(5), e329-e329 (2017-05-13)
Osteosarcoma is suggested to be caused by genetic and molecular alterations that disrupt osteoblast differentiation. Recent studies have reported that transmembrane protein 119 (TMEM119) contributes to osteoblast differentiation and bone development. However, the level of TMEM119 expression and its roles
Tobias Zrzavy et al.
Brain pathology (Zurich, Switzerland), 28(6), 791-805 (2017-12-10)
Inflammatory mechanisms, involving granulocytes, T-cells, B-cells, macrophages and activated microglia, have been suggested to play a pathogenic role in experimental models of stroke and may be targets for therapeutic intervention. However, knowledge on the inflammatory response in human stroke lesions
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica