SAB1412855
Monoclonal Anti-LRRC8A antibody produced in mouse
clone 8H9, purified immunoglobulin
Sinônimo(s):
Anti-FLJ10337, Anti-FLJ41617, Anti-KIAA1437, Anti-LRRC8
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Produtos recomendados
fonte biológica
mouse
conjugado
unconjugated
forma do anticorpo
purified immunoglobulin
tipo de produto de anticorpo
primary antibodies
clone
8H9, monoclonal
forma
buffered aqueous solution
peso molecular
antigen 36.74 kDa
reatividade de espécies
human
técnica(s)
ELISA: suitable
western blot: 1-5 μg/mL
Isotipo
IgG2a
nº de adesão GenBank
nº de adesão UniProt
Condições de expedição
dry ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... LRRC8A(56262)
Descrição geral
Leucine rich repeat containing eight family member A (LRRC8A) is a 94 kDa LRR-containing protein, encoded by the gene mapped to human chromosome 9q34.11. The encoded protein is ubiquitously expressed, but at higher levels on the surface of thymocytes than on other immune cells.
This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. (provided by RefSeq)
Imunogênio
LRRC8A (NP_062540.2, 711 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA
Sequence
QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA
Ações bioquímicas/fisiológicas
Leucine rich repeat containing eight family member A (LRRC8A) plays an important role in T cell development, survival and function. It also plays an essential role in B-cell development. In mouse, mutation in the gene leads to abnormalities of B cell development. In addition, mutation in the gene is also associated with the development of non-Bruton type agammaglobulinemia in humans.
Características e benefícios
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
forma física
Solution in phosphate buffered saline, pH 7.4
Informações legais
GenBank is a registered trademark of United States Department of Health and Human Services
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Ferramenta de seleção de produtos.
Código de classe de armazenamento
11 - Combustible Solids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Sonja Rutz et al.
Nature structural & molecular biology, 30(1), 52-61 (2022-12-16)
Volume-regulated anion channels (VRACs) participate in the cellular response to osmotic swelling. These membrane proteins consist of heteromeric assemblies of LRRC8 subunits, whose compositions determine permeation properties. Although structures of the obligatory LRRC8A, also referred to as SWELL1, have previously
Identification of a lung cancer antigen evading CTL attack due to loss of human leukocyte antigen (HLA) class I expression
Baba T,et al.
Cancer Science, 101(10), 2115-2120 (2010)
BTKbase: the mutation database for X?linked agammaglobulinemia.
Valiaho J, et al.
Human Mutation, 27(12), 1209-1217 (2006)
Lalit Kumar et al.
The Journal of experimental medicine, 211(5), 929-942 (2014-04-23)
Lrrc8a is a ubiquitously expressed gene that encodes a leucine-rich repeat (LRR)-containing protein detected at higher levels on the surface of thymocytes than on other immune cells. We generated Lrrc8a(-/-) mice to investigate the role of LRRC8A in lymphocyte development
Dawid Deneka et al.
Nature communications, 12(1), 5435-5435 (2021-09-16)
Members of the LRRC8 family form heteromeric assemblies, which function as volume-regulated anion channels. These modular proteins consist of a transmembrane pore and cytoplasmic leucine-rich repeat (LRR) domains. Despite their known molecular architecture, the mechanism of activation and the role
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica