SAB1412649

ANTI-TFAP4 antibody produced in mouse

clone 7C5, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): AP-4, TFAP4, bHLHc41
• Código UNSPSC: 12352203
• NACRES: NA.43

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 7C5, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen 36.74 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_003223
• nº de adesão UniProt: Q01664
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... TFAP4(7023)

Descrição

Descrição geral

Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]).[supplied by OMIM

Imunogênio

TFAP4 (NP_003214, 93 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable