SAB1405052

Monoclonal Anti-ANAPC2, (C-terminal) antibody produced in mouse

clone 7F2, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): APC2, RP11-350O14.5
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 7F2, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~37.88 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• nº de adesão NCBI: NM_013366
• nº de adesão UniProt: Q9UJX6
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ANAPC2(29882)

Descrição

Descrição geral

A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the 26S proteasome. Biochemical studies have shown that the vertebrate APC contains eight subunits. The composition of the APC is highly conserved in organisms from yeast to humans. The product of this gene is a component of the complex and shares sequence similarity with a recently identified family of proteins called cullins, which may also be involved in ubiquitin-mediated degradation. (provided by RefSeq)

Imunogênio

ANAPC2 (NP_037498, 716 a.a. ~ 822 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable